PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00578g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 196aa    MW: 22602.9 Da    PI: 7.4499
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00578g02001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.61.6e-181665251
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                               i++k  r+v+fskR++ ++KKAe LS L+ ae av++fs++gk y y+s
  Peinf101Scf00578g02001.1 16 LIKSKEARYVSFSKRKASLFKKAEDLSNLTKAELAVLLFSPSGKTYSYCS 65
                              69**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-22766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.446767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-22889IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-15929IPR002100Transcription factor, MADS-box
PfamPF003191.3E-181763IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-152944IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-154465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MERKVSKGRQ KIEMKLIKSK EARYVSFSKR KASLFKKAED LSNLTKAELA VLLFSPSGKT  60
YSYCSTSIEE ITNKFFQWKQ DESNDDESDH NNIDKLLDVY KDLCDEIKII NDQEKSRRWR  120
YKIIHPDSEI PPDKNMLDRL VECKSQLDIL KKMAIHLQEL MPSTSESVPF TSAKPHLSID  180
LNVLPGLDEG ECSGTK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM1AZT97e-56M1AZT9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000338612e-55(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17801260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.16e-17AGAMOUS-like 29